Lineage for d4xkmc_ (4xkm C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2839044Superfamily c.1.15: Xylose isomerase-like [51658] (8 families) (S)
    different families share similar but non-identical metal-binding sites
  5. 2839418Family c.1.15.0: automated matches [191634] (1 protein)
    not a true family
  6. 2839419Protein automated matches [191168] (5 species)
    not a true protein
  7. 2839420Species Bacteroides thetaiotaomicron [TaxId:226186] [311472] (1 PDB entry)
  8. 2839423Domain d4xkmc_: 4xkm C: [310043]
    automated match to d1a0ea_
    complexed with mn

Details for d4xkmc_

PDB Entry: 4xkm (more details), 2.1 Å

PDB Description: crystal structure of xylose isomerase from an human intestinal tract microbe bacteroides thetaiotaomicron
PDB Compounds: (C:) xylose isomerase

SCOPe Domain Sequences for d4xkmc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xkmc_ c.1.15.0 (C:) automated matches {Bacteroides thetaiotaomicron [TaxId: 226186]}
keffpgiekikfegkdsknpmafryydaekvingkkmkdwlrfamawwhtlcaeggdqfg
ggtkqfpwngnadaiqaakdkmdagfefmqkmgieyycfhdvdlvsegasveeyeanlke
ivayakqkqaetgikllwgtanvfgharymngaatnpdfdvvaraavqiknaidatielg
genyvfwggregymsllntdqkrekehlaqmltiardyarargfkgtfliepkpmeptkh
qydvdtetvigflkahgldkdfkvnievnhatlaghtfehelavavdngmlgsidanrgd
yqngwdtdqfpidnyeltqammqiirngglgtggtnfdaktrrnstdledifiahiagmd
amaralesaaalldespykkmladryasfdggkgkefedgkltledvvayaktkgepkqt
sgkqelyeailnmyc

SCOPe Domain Coordinates for d4xkmc_:

Click to download the PDB-style file with coordinates for d4xkmc_.
(The format of our PDB-style files is described here.)

Timeline for d4xkmc_: