Lineage for d4xk8e_ (4xk8 E:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2053585Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2054490Superfamily b.34.4: Electron transport accessory proteins [50090] (5 families) (S)
  5. 2054583Family b.34.4.0: automated matches [191659] (1 protein)
    not a true family
  6. 2054584Protein automated matches [191237] (4 species)
    not a true protein
  7. 2054618Species Pea (Pisum sativum) [TaxId:3888] [311431] (3 PDB entries)
  8. 2054620Domain d4xk8e_: 4xk8 E: [310037]
    Other proteins in same PDB: d4xk81_, d4xk82_, d4xk83_, d4xk84_, d4xk86_, d4xk87_, d4xk88_, d4xk89_, d4xk8a_, d4xk8b_, d4xk8c_, d4xk8d_, d4xk8f_, d4xk8j_
    automated match to d4y28e_
    complexed with bcr, chl, cla, dgd, htg, lhg, lmg, lmt, lut, pqn, sf4, xat

Details for d4xk8e_

PDB Entry: 4xk8 (more details), 2.8 Å

PDB Description: crystal structure of plant photosystem i-lhci super-complex at 2.8 angstrom resolution
PDB Compounds: (E:) Putative uncharacterized protein

SCOPe Domain Sequences for d4xk8e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xk8e_ b.34.4.0 (E:) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
gpkrgakvkilrkesywykgtgsvvavdqdpntrypvvvrfnkvnyanvstnnyaldeiq
eve

SCOPe Domain Coordinates for d4xk8e_:

Click to download the PDB-style file with coordinates for d4xk8e_.
(The format of our PDB-style files is described here.)

Timeline for d4xk8e_: