![]() | Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
![]() | Fold f.43: Chlorophyll a-b binding protein [103510] (1 superfamily) membrane all-alpha fold; three transmembrane helices |
![]() | Superfamily f.43.1: Chlorophyll a-b binding protein [103511] (2 families) ![]() duplication: contains two structural repeats |
![]() | Family f.43.1.0: automated matches [276197] (1 protein) not a true family |
![]() | Protein automated matches [276200] (4 species) not a true protein |
![]() | Species Pea (Pisum sativum) [TaxId:3888] [276203] (9 PDB entries) |
![]() | Domain d4xk88_: 4xk8 8: [310031] Other proteins in same PDB: d4xk8a_, d4xk8b_, d4xk8c_, d4xk8d_, d4xk8e_, d4xk8f_, d4xk8j_ automated match to d4y282_ complexed with bcr, chl, cla, dgd, htg, lhg, lmg, lmt, lut, pqn, sf4, xat |
PDB Entry: 4xk8 (more details), 2.8 Å
SCOPe Domain Sequences for d4xk88_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4xk88_ f.43.1.0 (8:) automated matches {Pea (Pisum sativum) [TaxId: 3888]} rplwfaskqslsyldgslpgdygfdplglsdpegtggfieprwlaygevingrfamlgav gaiapeylgkvglipqetalawfqtgvippagtynywadnytlfvlemalmgfaehrrfq dwakpgsmgkqyflglekgfggsgnpaypggpffnplgfgkdekslkelklkevkngrla mlailgyfiqglvtgvgpyqnlldhvadpvnnnvlts
Timeline for d4xk88_: