Lineage for d4xk87_ (4xk8 7:)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2256154Fold f.43: Chlorophyll a-b binding protein [103510] (1 superfamily)
    membrane all-alpha fold; three transmembrane helices
  4. 2256155Superfamily f.43.1: Chlorophyll a-b binding protein [103511] (2 families) (S)
    duplication: contains two structural repeats
  5. 2256178Family f.43.1.0: automated matches [276197] (1 protein)
    not a true family
  6. 2256179Protein automated matches [276200] (2 species)
    not a true protein
  7. 2256180Species Pea (Pisum sativum) [TaxId:3888] [276203] (4 PDB entries)
  8. 2256188Domain d4xk87_: 4xk8 7: [310030]
    Other proteins in same PDB: d4xk8a_, d4xk8b_, d4xk8c_, d4xk8d_, d4xk8e_, d4xk8f_, d4xk8j_
    automated match to d4y282_
    complexed with bcr, chl, cla, dgd, htg, lhg, lmg, lmt, lut, pqn, sf4, xat

Details for d4xk87_

PDB Entry: 4xk8 (more details), 2.8 Å

PDB Description: crystal structure of plant photosystem i-lhci super-complex at 2.8 angstrom resolution
PDB Compounds: (7:) Type II chlorophyll a/b binding protein from photosystem I

SCOPe Domain Sequences for d4xk87_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xk87_ f.43.1.0 (7:) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
pdrplwfpgstpppwldgslpgdfgfdplglgsdpeslrwnvqaelvhsrwamlgaagif
ipefltklgilntpswytageqeyftdtttlfivelvfigwaegrrwadilnpgcvntdp
ifpnnkltgtdvgypgglwfdplgwgsaspqklkelrtkeikngrlamlavmgawfqhiy
tgtgpidnlfahladpghatifaaft

SCOPe Domain Coordinates for d4xk87_:

Click to download the PDB-style file with coordinates for d4xk87_.
(The format of our PDB-style files is described here.)

Timeline for d4xk87_: