Class f: Membrane and cell surface proteins and peptides [56835] (59 folds) |
Fold f.43: Chlorophyll a-b binding protein [103510] (1 superfamily) membrane all-alpha fold; three transmembrane helices |
Superfamily f.43.1: Chlorophyll a-b binding protein [103511] (2 families) duplication: contains two structural repeats |
Family f.43.1.0: automated matches [276197] (1 protein) not a true family |
Protein automated matches [276200] (2 species) not a true protein |
Species Pea (Pisum sativum) [TaxId:3888] [276203] (4 PDB entries) |
Domain d4xk82_: 4xk8 2: [310026] Other proteins in same PDB: d4xk8a_, d4xk8b_, d4xk8c_, d4xk8d_, d4xk8e_, d4xk8f_, d4xk8j_ automated match to d4y282_ complexed with bcr, chl, cla, dgd, htg, lhg, lmg, lmt, lut, pqn, sf4, xat |
PDB Entry: 4xk8 (more details), 2.8 Å
SCOPe Domain Sequences for d4xk82_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4xk82_ f.43.1.0 (2:) automated matches {Pea (Pisum sativum) [TaxId: 3888]} pdrplwfpgstpppwldgslpgdfgfdplglgsdpeslrwnvqaelvhsrwamlgaagif ipefltklgilntpswytageqeyftdtttlfivelvfigwaegrrwadilnpgcvntdp ifpnnkltgtdvgypgglwfdplgwgsaspqklkelrtkeikngrlamlavmgawfqhiy tgtgpidnlfahladpghatifaaft
Timeline for d4xk82_: