SCOPe 2.07: Domain d4xk81_: 4xk8 1:

Lineage for d4xk81_ (4xk8 1:)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.43: Chlorophyll a-b binding protein [103510] (1 superfamily)
   membrane all-alpha fold; three transmembrane helices

4. Superfamily f.43.1: Chlorophyll a-b binding protein [103511] (2 families)
   duplication: contains two structural repeats

5. Family f.43.1.0: automated matches [276197] (1 protein)
   not a true family

6. Protein automated matches [276200] (4 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [311476] (1 PDB entry)

8. Domain d4xk81_: 4xk8 1: [310025]
   Other proteins in same PDB: d4xk8a_, d4xk8b_, d4xk8c_, d4xk8d_, d4xk8e_, d4xk8f_, d4xk8j_
   automated match to d4y282_
   complexed with bcr, chl, cla, dgd, htg, lhg, lmg, lmt, lut, pqn, sf4, xat

Details for d4xk81_

PDB Entry: 4xk8, 2.8 Å

PDB Description: crystal structure of plant photosystem i-lhci super-complex at 2.8 angstrom resolution

PDB Compounds: (1:) Chlorophyll a-b binding protein 6, chloroplastic

SCOPe Domain Sequences for d4xk81_:

Sequence; same for both SEQRES and ATOM records:

>d4xk81_ f.43.1.0 (1:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
ahwmpgeprpayldgsapgdfgfdplglgevpanlerykeselihcrwamlavpgilvpe
algygnwvkaqewaalpggqatylgnpvpwgtlptilaieflaiafvehqrsmekdpekk
kypggafdplgyskdpkkleelkvkeikngrlallafvgfcvqqsaypgtgplenlathl
adpwhnnigdiligf

Timeline for d4xk81_:

• d4xk81_ first appeared in SCOPe 2.06
  
• d4xk81_ appears in the current release, SCOPe 2.08