Lineage for d4xela_ (4xel A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2049950Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2052342Superfamily b.40.5: Inorganic pyrophosphatase [50324] (2 families) (S)
  5. 2052343Family b.40.5.1: Inorganic pyrophosphatase [50325] (2 protein domains)
    barrel, closed; n=5, S=8
  6. 2052432Protein automated matches [191079] (4 species)
    not a true protein
  7. 2052442Species Pseudomonas aeruginosa [TaxId:208964] [311471] (1 PDB entry)
  8. 2052443Domain d4xela_: 4xel A: [310019]
    automated match to d1jfda_
    complexed with 12p, cl, mg, na

Details for d4xela_

PDB Entry: 4xel (more details), 2 Å

PDB Description: crystal structure of inorganic pyrophosphatase (ppase) from pseudomonas aeruginosa
PDB Compounds: (A:) inorganic pyrophosphatase

SCOPe Domain Sequences for d4xela_:

Sequence, based on SEQRES records: (download)

>d4xela_ b.40.5.1 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
syskipagkdlpndiyvaieipanhapikyeidkdtdclfvdrfmatpmfypanygfipn
tladdgdpldvlvvtpypvapgsvirarpvgvlhmtdeaggdakliavphdklsvlykdv
keytdlpallleqikhffenykdlekgkwvkvegwgnadaaraeitkavaafqk

Sequence, based on observed residues (ATOM records): (download)

>d4xela_ b.40.5.1 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
syskipagkdlpndiyvaieipanhapikyeidkdtdclfvdrfmatpmfypanygfipn
tladdgdpldvlvvtpypvapgsvirarpvgvlhmtdeaggdakliavphdklsvlykdv
keytdlpallleqikhffenykdlekgvkvegwgnadaaraeitkavaafqk

SCOPe Domain Coordinates for d4xela_:

Click to download the PDB-style file with coordinates for d4xela_.
(The format of our PDB-style files is described here.)

Timeline for d4xela_:

  • d4xela_ is new in SCOPe 2.06-stable