Class b: All beta proteins [48724] (177 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) |
Family b.29.1.0: automated matches [191363] (1 protein) not a true family |
Protein automated matches [190437] (53 species) not a true protein |
Species Mycobacterium thermoresistibile [TaxId:1078020] [311470] (1 PDB entry) |
Domain d4xdqa_: 4xdq A: [310018] automated match to d2hyka_ complexed with bez, ca, cd, cl, edo, mg |
PDB Entry: 4xdq (more details), 1.35 Å
SCOPe Domain Sequences for d4xdqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4xdqa_ b.29.1.0 (A:) automated matches {Mycobacterium thermoresistibile [TaxId: 1078020]} llfadefdgpagsppdpakwfivperetirnpvewdkpynmgryvtdqehvfhdgngnlv iratrgpganirekyasakivglwrggvgttwearvklncltdgawpafwllnddpvrga eidifewygnrdwpsgatvhakldgtmfqtqnypvdsawhtwrmtwlpsgmyfwqdyepg kepfftvlanslpewpfndpgytmvpvfniavggsggrepaggsypadmiidwirvf
Timeline for d4xdqa_: