Lineage for d4xdqa_ (4xdq A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2049732Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2049733Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2051795Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2051796Protein automated matches [190437] (53 species)
    not a true protein
  7. 2052244Species Mycobacterium thermoresistibile [TaxId:1078020] [311470] (1 PDB entry)
  8. 2052245Domain d4xdqa_: 4xdq A: [310018]
    automated match to d2hyka_
    complexed with bez, ca, cd, cl, edo, mg

Details for d4xdqa_

PDB Entry: 4xdq (more details), 1.35 Å

PDB Description: Crystal structure of a Glycoside hydrolase family protein (Rv0315 ortholog) from Mycobacterium thermorestibile
PDB Compounds: (A:) Glycoside hydrolase family protein

SCOPe Domain Sequences for d4xdqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xdqa_ b.29.1.0 (A:) automated matches {Mycobacterium thermoresistibile [TaxId: 1078020]}
llfadefdgpagsppdpakwfivperetirnpvewdkpynmgryvtdqehvfhdgngnlv
iratrgpganirekyasakivglwrggvgttwearvklncltdgawpafwllnddpvrga
eidifewygnrdwpsgatvhakldgtmfqtqnypvdsawhtwrmtwlpsgmyfwqdyepg
kepfftvlanslpewpfndpgytmvpvfniavggsggrepaggsypadmiidwirvf

SCOPe Domain Coordinates for d4xdqa_:

Click to download the PDB-style file with coordinates for d4xdqa_.
(The format of our PDB-style files is described here.)

Timeline for d4xdqa_: