SCOPe 2.08: Domain d4xcwf1: 4xcw F:1-176

Lineage for d4xcwf1 (4xcw F:1-176)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.57: Molybdenum cofactor biosynthesis proteins [53217] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 5 strands; order: 21354, strand 5 is antiparallel to the rest; permutation of the Phosphorylase/hydrolase-like fold

4. Superfamily c.57.1: Molybdenum cofactor biosynthesis proteins [53218] (3 families)

5. Family c.57.1.1: MogA-like [53219] (6 proteins)

6. Protein automated matches [190868] (2 species)
   not a true protein

7. Species Helicobacter pylori [TaxId:85963] [311469] (1 PDB entry)

8. Domain d4xcwf1: 4xcw F:1-176 [310014]
   Other proteins in same PDB: d4xcwa2, d4xcwb2, d4xcwc2, d4xcwd2, d4xcwe2, d4xcwf2
   automated match to d3k6aa_

Details for d4xcwf1

PDB Entry: 4xcw, 1.8 Å

PDB Description: Crystal structure of molybdenum cofactor biosynthesis protein MogA from Helicobacter pylori str. J99

PDB Compounds: (F:) Molybdopterin adenylyltransferase

SCOPe Domain Sequences for d4xcwf1:

Sequence, based on SEQRES records:

>d4xcwf1 c.57.1.1 (F:1-176) automated matches {Helicobacter pylori [TaxId: 85963]}
mqtihigvlsasdraskgvyedlsgkaiqevlseyllnplefhyeivaderdliekslik
mcdeyqcdlvvttggtgpalrditpeatkkvcqkmlpgfgelmrmtslkyvptailsrqs
agirnksliinlpgkpksirecleavfpaipycvdlilgnymqvnekniqafrpkq

Sequence, based on observed residues (ATOM records):

>d4xcwf1 c.57.1.1 (F:1-176) automated matches {Helicobacter pylori [TaxId: 85963]}
mqtihigvlsasdrasdlsgkaiqevlseyllnplefhyeivaderdliekslikmcdey
qcdlvvttggtgpalrditpeatkkvcqkmlpgfgelmrmtslkyvptailsrqsagirn
ksliinlpgkpksirecleavfpaipycvdlilgnymqvnekniqafrpkq

Timeline for d4xcwf1:

• d4xcwf1 first appeared in SCOPe 2.06
  
• d4xcwf1 appears in SCOPe 2.07