| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.57: Molybdenum cofactor biosynthesis proteins [53217] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 5 strands; order: 21354, strand 5 is antiparallel to the rest; permutation of the Phosphorylase/hydrolase-like fold |
Superfamily c.57.1: Molybdenum cofactor biosynthesis proteins [53218] (3 families) ![]() |
| Family c.57.1.1: MogA-like [53219] (6 proteins) |
| Protein automated matches [190868] (2 species) not a true protein |
| Species Helicobacter pylori [TaxId:85963] [311469] (1 PDB entry) |
| Domain d4xcwb1: 4xcw B:1-176 [310006] Other proteins in same PDB: d4xcwa2, d4xcwb2, d4xcwc2, d4xcwd2, d4xcwe2, d4xcwf2 automated match to d3k6aa_ |
PDB Entry: 4xcw (more details), 1.8 Å
SCOPe Domain Sequences for d4xcwb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4xcwb1 c.57.1.1 (B:1-176) automated matches {Helicobacter pylori [TaxId: 85963]}
mqtihigvlsasdraskgvyedlsgkaiqevlseyllnplefhyeivaderdliekslik
mcdeyqcdlvvttggtgpalrditpeatkkvcqkmlpgfgelmrmtslkyvptailsrqs
agirnksliinlpgkpksirecleavfpaipycvdlilgnymqvnekniqafrpkq
Timeline for d4xcwb1: