Lineage for d4xcwb1 (4xcw B:1-176)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2142860Fold c.57: Molybdenum cofactor biosynthesis proteins [53217] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands; order: 21354, strand 5 is antiparallel to the rest; permutation of the Phosphorylase/hydrolase-like fold
  4. 2142861Superfamily c.57.1: Molybdenum cofactor biosynthesis proteins [53218] (3 families) (S)
  5. 2142862Family c.57.1.1: MogA-like [53219] (6 proteins)
  6. 2142934Protein automated matches [190868] (2 species)
    not a true protein
  7. 2142948Species Helicobacter pylori [TaxId:85963] [311469] (1 PDB entry)
  8. 2142950Domain d4xcwb1: 4xcw B:1-176 [310006]
    Other proteins in same PDB: d4xcwa2, d4xcwb2, d4xcwc2, d4xcwd2, d4xcwe2, d4xcwf2
    automated match to d3k6aa_

Details for d4xcwb1

PDB Entry: 4xcw (more details), 1.8 Å

PDB Description: Crystal structure of molybdenum cofactor biosynthesis protein MogA from Helicobacter pylori str. J99
PDB Compounds: (B:) Molybdopterin adenylyltransferase

SCOPe Domain Sequences for d4xcwb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xcwb1 c.57.1.1 (B:1-176) automated matches {Helicobacter pylori [TaxId: 85963]}
mqtihigvlsasdraskgvyedlsgkaiqevlseyllnplefhyeivaderdliekslik
mcdeyqcdlvvttggtgpalrditpeatkkvcqkmlpgfgelmrmtslkyvptailsrqs
agirnksliinlpgkpksirecleavfpaipycvdlilgnymqvnekniqafrpkq

SCOPe Domain Coordinates for d4xcwb1:

Click to download the PDB-style file with coordinates for d4xcwb1.
(The format of our PDB-style files is described here.)

Timeline for d4xcwb1: