![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily) 8-stranded mixed beta-sheet; 2 layers: alpha/beta |
![]() | Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) ![]() |
![]() | Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (2 proteins) |
![]() | Protein automated matches [190229] (11 species) not a true protein |
![]() | Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [269221] (8 PDB entries) |
![]() | Domain d4xcla_: 4xcl A: [310003] automated match to d2xjxa_ complexed with ags, mg |
PDB Entry: 4xcl (more details), 1.21 Å
SCOPe Domain Sequences for d4xcla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4xcla_ d.122.1.1 (A:) automated matches {Slime mold (Dictyostelium discoideum) [TaxId: 44689]} maesqverftfqaeinqlmsliintfysnkevflrelisnasdaldkiryqsltdasvle skteleikiipdktaktltlidsgigmtktdmvknlgtiarsgtknfmeqlqsgaadism igqfgvgfysaylvadtvivhsknnddeqyvwessaggeftialdhteplgrgtkivlhm kedqldyldetkiknlvkkhsefiqypislltik
Timeline for d4xcla_: