Lineage for d4xcja_ (4xcj A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2973214Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2973215Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2973216Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (2 proteins)
  6. 2973542Protein automated matches [190229] (13 species)
    not a true protein
  7. 2973747Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [269221] (8 PDB entries)
  8. 2973751Domain d4xcja_: 4xcj A: [310002]
    automated match to d2xjxa_
    complexed with adp, mg

Details for d4xcja_

PDB Entry: 4xcj (more details), 1.75 Å

PDB Description: n-terminal domain of hsp90 from dictyostelium discoideum in complex with adp
PDB Compounds: (A:) Heat shock cognate 90 kDa protein

SCOPe Domain Sequences for d4xcja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xcja_ d.122.1.1 (A:) automated matches {Slime mold (Dictyostelium discoideum) [TaxId: 44689]}
maesqverftfqaeinqlmsliintfysnkevflrelisnasdaldkiryqsltdasvle
skteleikiipdktaktltlidsgigmtktdmvknlgtiarsgtknfmeqlqsgaadism
igqfgvgfysaylvadtvivhsknnddeqyvwessaggeftialdhteplgrgtkivlhm
kedqldyldetkiknlvkkhsefiqypislltike

SCOPe Domain Coordinates for d4xcja_:

Click to download the PDB-style file with coordinates for d4xcja_.
(The format of our PDB-style files is described here.)

Timeline for d4xcja_: