| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily) 8-stranded mixed beta-sheet; 2 layers: alpha/beta |
Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) ![]() |
| Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (2 proteins) |
| Protein automated matches [190229] (13 species) not a true protein |
| Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [269221] (8 PDB entries) |
| Domain d4xc0a_: 4xc0 A: [310001] automated match to d2xjxa_ complexed with acp, mg, peg |
PDB Entry: 4xc0 (more details), 1.77 Å
SCOPe Domain Sequences for d4xc0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4xc0a_ d.122.1.1 (A:) automated matches {Slime mold (Dictyostelium discoideum) [TaxId: 44689]}
aesqverftfqaeinqlmsliintfysnkevflrelisnasdaldkiryqsltdasvles
kteleikiipdktaktltlidsgigmtktdmvknlgtiarsgtknfmeqlqsgaadismi
gqfgvgfysaylvadtvivhsknnddeqyvwessaggeftialdhteplgrgtkivlhmk
edqldyldetkiknlvkkhsefiqypislltik
Timeline for d4xc0a_: