Lineage for d4xbdb1 (4xbd B:1-173)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2064170Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2064171Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2066547Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 proteins)
  6. 2066750Protein automated matches [190384] (19 species)
    not a true protein
  7. 2066843Species Norwalk virus (strain gi/human/united states/norwalk/1968) [TaxId:524364] [311468] (3 PDB entries)
  8. 2066845Domain d4xbdb1: 4xbd B:1-173 [309999]
    Other proteins in same PDB: d4xbda2, d4xbdb2
    automated match to d2fyqa_
    complexed with m40

Details for d4xbdb1

PDB Entry: 4xbd (more details), 1.45 Å

PDB Description: 1.45a resolution structure of norovirus 3cl protease complex with a covalently bound dipeptidyl inhibitor (1r,2s)-2-({n-[(benzyloxy) carbonyl]-3-cyclohexyl-l-alanyl}amino)-1-hydroxy-3-[(3s)-2- oxopyrrolidin-3-yl]propane-1-sulfonic acid (orthorhombic p form)
PDB Compounds: (B:) 3C-like protease

SCOPe Domain Sequences for d4xbdb1:

Sequence, based on SEQRES records: (download)

>d4xbdb1 b.47.1.4 (B:1-173) automated matches {Norwalk virus (strain gi/human/united states/norwalk/1968) [TaxId: 524364]}
apptlwsrvtkfgsgwgfwvsptvfittthvvptgvkeffgeplssiaihqageftqfrf
skkmrpdltgmvleegcpegtvcsvlikrdsgellplavrmgaiasmriqgrlvhgqsgm
lltganakgmdlgtipgdcgapyvhkrgndwvvcgvhaaatksgntvvcavqa

Sequence, based on observed residues (ATOM records): (download)

>d4xbdb1 b.47.1.4 (B:1-173) automated matches {Norwalk virus (strain gi/human/united states/norwalk/1968) [TaxId: 524364]}
apptlwsrvtkfgsgwgfwvsptvfittthvvptgvkeffgeplssiaihqageftqfrf
skkmrpdltgmvleegcpegtvcsvlikrdsgellplavrmgaiasmriqgrlvhgqsgm
lltlgtipgdcgapyvhkrgndwvvcgvhaaatksgntvvcavqa

SCOPe Domain Coordinates for d4xbdb1:

Click to download the PDB-style file with coordinates for d4xbdb1.
(The format of our PDB-style files is described here.)

Timeline for d4xbdb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4xbdb2