Lineage for d4xbca1 (4xbc A:1-181)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2387558Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2387559Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2389935Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 protein domains)
  6. 2390138Protein automated matches [190384] (19 species)
    not a true protein
  7. 2390231Species Norwalk virus (strain gi/human/united states/norwalk/1968) [TaxId:524364] [311468] (3 PDB entries)
  8. 2390234Domain d4xbca1: 4xbc A:1-181 [309995]
    Other proteins in same PDB: d4xbca2
    automated match to d2fyqa_
    complexed with m40, pg4

Details for d4xbca1

PDB Entry: 4xbc (more details), 1.6 Å

PDB Description: 1.60 a resolution structure of norovirus 3cl protease complex with a covalently bound dipeptidyl inhibitor (1r,2s)-2-({n-[(benzyloxy) carbonyl]-3-cyclohexyl-l-alanyl}amino)-1-hydroxy-3-[(3s)-2- oxopyrrolidin-3-yl]propane-1-sulfonic acid (hexagonal form)
PDB Compounds: (A:) 3C-like protease

SCOPe Domain Sequences for d4xbca1:

Sequence, based on SEQRES records: (download)

>d4xbca1 b.47.1.4 (A:1-181) automated matches {Norwalk virus (strain gi/human/united states/norwalk/1968) [TaxId: 524364]}
apptlwsrvtkfgsgwgfwvsptvfittthvvptgvkeffgeplssiaihqageftqfrf
skkmrpdltgmvleegcpegtvcsvlikrdsgellplavrmgaiasmriqgrlvhgqsgm
lltganakgmdlgtipgdcgapyvhkrgndwvvcgvhaaatksgntvvcavqagegetal
e

Sequence, based on observed residues (ATOM records): (download)

>d4xbca1 b.47.1.4 (A:1-181) automated matches {Norwalk virus (strain gi/human/united states/norwalk/1968) [TaxId: 524364]}
apptlwsrvtkfgsgwgfwvsptvfittthvvptgvkeffgeplssiaihqageftqfrf
skkmrpdltgmvleegcpegtvcsvlikrdsgellplavrmgaiasmriqgrlvhgqsgm
lllgtipgdcgapyvhkrgndwvvcgvhaaatksgntvvcavqagegetale

SCOPe Domain Coordinates for d4xbca1:

Click to download the PDB-style file with coordinates for d4xbca1.
(The format of our PDB-style files is described here.)

Timeline for d4xbca1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4xbca2