| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) ![]() automatically mapped to Pfam PF00081 |
| Family a.2.11.0: automated matches [227154] (1 protein) not a true family |
| Protein automated matches [226859] (39 species) not a true protein |
| Species Nematode (Caenorhabditis elegans) [TaxId:6239] [225668] (8 PDB entries) |
| Domain d4x9qc1: 4x9q C:1-85 [309991] Other proteins in same PDB: d4x9qa2, d4x9qc2 automated match to d3dc5a1 complexed with mli, mn, so4 |
PDB Entry: 4x9q (more details), 1.77 Å
SCOPe Domain Sequences for d4x9qc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4x9qc1 a.2.11.0 (C:1-85) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
khtlpdlpfdyadlepvisheimqlhhqkhhatyvnnlnqieeklheavskgnlkeaial
qpalkfnggghinhsifwtnlakdg
Timeline for d4x9qc1: