Lineage for d4x7yb_ (4x7y B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2145089Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2145090Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2146539Family c.66.1.61: TylF O-methyltransferase-like [310662] (4 proteins)
    Pfam PF05711
  6. 2146552Protein Mycinamicin III 3'-O-methyltransferase MycF [310830] (1 species)
  7. 2146553Species Micromonospora griseorubida [TaxId:28040] [311099] (8 PDB entries)
  8. 2146555Domain d4x7yb_: 4x7y B: [309984]
    automated match to d4x7ua_
    complexed with mg, sah

Details for d4x7yb_

PDB Entry: 4x7y (more details), 1.4 Å

PDB Description: mycf mycinamicin iii 3'-o-methyltransferase (e35q, m56a, e139a variant) in complex with mg and sah
PDB Compounds: (B:) Mycinamicin III 3''-O-methyltransferase

SCOPe Domain Sequences for d4x7yb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4x7yb_ c.66.1.61 (B:) Mycinamicin III 3'-O-methyltransferase MycF {Micromonospora griseorubida [TaxId: 28040]}
stgvelyldllkrtvsnfiyqdathvaglitqaafveearesgedyptvahtaigmkrln
nlqhcvesalrdgvpgdvletgvwrggacifargilkaydvrdrtvwvadsfqgfpkitd
ddhpmdaemnlhqynaavdlptslatvqrnfsrygllddqvrflpgwfkdtmptapferl
avlrmdgdsygatmdvlthayprlspggfaiiddycipacreavheyrdrhgisdeivei
drqgvywrrs

SCOPe Domain Coordinates for d4x7yb_:

Click to download the PDB-style file with coordinates for d4x7yb_.
(The format of our PDB-style files is described here.)

Timeline for d4x7yb_: