SCOPe 2.08: Domain d4x7yb_: 4x7y B:

Lineage for d4x7yb_ (4x7y B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families)

5. Family c.66.1.61: TylF O-methyltransferase-like [310662] (4 proteins)
   Pfam PF05711

6. Protein Mycinamicin III 3'-O-methyltransferase MycF [310830] (1 species)

7. Species Micromonospora griseorubida [TaxId:28040] [311099] (8 PDB entries)

8. Domain d4x7yb_: 4x7y B: [309984]
   automated match to d4x7ua_
   complexed with mg, sah

Details for d4x7yb_

PDB Entry: 4x7y, 1.4 Å

PDB Description: mycf mycinamicin iii 3'-o-methyltransferase (e35q, m56a, e139a variant) in complex with mg and sah

PDB Compounds: (B:) Mycinamicin III 3''-O-methyltransferase

SCOPe Domain Sequences for d4x7yb_:

Sequence; same for both SEQRES and ATOM records:

>d4x7yb_ c.66.1.61 (B:) Mycinamicin III 3'-O-methyltransferase MycF {Micromonospora griseorubida [TaxId: 28040]}
stgvelyldllkrtvsnfiyqdathvaglitqaafveearesgedyptvahtaigmkrln
nlqhcvesalrdgvpgdvletgvwrggacifargilkaydvrdrtvwvadsfqgfpkitd
ddhpmdaemnlhqynaavdlptslatvqrnfsrygllddqvrflpgwfkdtmptapferl
avlrmdgdsygatmdvlthayprlspggfaiiddycipacreavheyrdrhgisdeivei
drqgvywrrs

Timeline for d4x7yb_:

• d4x7yb_ first appeared in SCOPe 2.06
  
• d4x7yb_ appears in SCOPe 2.07