Lineage for d4x7fc1 (4x7f C:1-112)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2745477Species Vicugna pacos [TaxId:30538] [189756] (82 PDB entries)
  8. 2745508Domain d4x7fc1: 4x7f C:1-112 [309970]
    Other proteins in same PDB: d4x7fa_, d4x7fb_, d4x7fc2, d4x7fd2
    automated match to d4x7dd_
    complexed with edo, imd, na, po4

Details for d4x7fc1

PDB Entry: 4x7f (more details), 1.7 Å

PDB Description: crystal structure of norovirus gii.10 p domain in complex with nano-25
PDB Compounds: (C:) Nano-25 Nanobody

SCOPe Domain Sequences for d4x7fc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4x7fc1 b.1.1.1 (C:1-112) automated matches {Vicugna pacos [TaxId: 30538]}
dvqlvesggglvqpggslrlscaasesilsfnhmawyrqgpgeqrelvavitregstdya
dsvkgrftisrdnaknmvyllmsnlrpedtavyycnrgisnpwgqgtqvtvs

SCOPe Domain Coordinates for d4x7fc1:

Click to download the PDB-style file with coordinates for d4x7fc1.
(The format of our PDB-style files is described here.)

Timeline for d4x7fc1: