SCOPe 2.08: Domain d4x7fc1: 4x7f C:1-112

Lineage for d4x7fc1 (4x7f C:1-112)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Vicugna pacos [TaxId:30538] [189756] (82 PDB entries)

8. Domain d4x7fc1: 4x7f C:1-112 [309970]
   Other proteins in same PDB: d4x7fa_, d4x7fb_, d4x7fc2, d4x7fd2
   automated match to d4x7dd_
   complexed with edo, imd, na, po4

Details for d4x7fc1

PDB Entry: 4x7f, 1.7 Å

PDB Description: crystal structure of norovirus gii.10 p domain in complex with nano-25

PDB Compounds: (C:) Nano-25 Nanobody

SCOPe Domain Sequences for d4x7fc1:

Sequence; same for both SEQRES and ATOM records:

>d4x7fc1 b.1.1.1 (C:1-112) automated matches {Vicugna pacos [TaxId: 30538]}
dvqlvesggglvqpggslrlscaasesilsfnhmawyrqgpgeqrelvavitregstdya
dsvkgrftisrdnaknmvyllmsnlrpedtavyycnrgisnpwgqgtqvtvs

Timeline for d4x7fc1:

• d4x7fc1 first appeared in SCOPe 2.06
  
• d4x7fc1 appears in SCOPe 2.07