Lineage for d4x5za2 (4x5z A:231-588)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2007336Superfamily a.118.8: TPR-like [48452] (9 families) (S)
  5. 2007337Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (20 protein domains)
  6. 2007372Protein Menin C-terminal domain [310725] (2 species)
  7. 2007373Species Human (Homo sapiens) [TaxId:9606] [310974] (23 PDB entries)
  8. 2007386Domain d4x5za2: 4x5z A:231-588 [309965]
    Other proteins in same PDB: d4x5za1
    automated match to d3u85a2
    complexed with 3xy, dms, edo, pg4, so4

Details for d4x5za2

PDB Entry: 4x5z (more details), 1.86 Å

PDB Description: menin in complex with mi-136
PDB Compounds: (A:) Menin

SCOPe Domain Sequences for d4x5za2:

Sequence, based on SEQRES records: (download)

>d4x5za2 a.118.8.1 (A:231-588) Menin C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
drkmevafmvcainpsidlhtdslellqlqqkllwllydlghlerypmalgnladleele
ptpgrpdpltlyhkgiasaktyyrdehiypymylagyhcrnrnvrealqawadtatviqd
ynycredeeiykeffevandvipnllkeaaslleagsqgsalqdpecfahllrfydgick
weegsptpvlhvgwatflvqslgrfegqvrqkvrivsvpapaaspppegpvltfqsekmk
gmkellvatkinssaiklqltaqsqvqmk

Sequence, based on observed residues (ATOM records): (download)

>d4x5za2 a.118.8.1 (A:231-588) Menin C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
drkmevafmvcainpsidlhtdslellqlqqkllwllydlghlerypmalgnladleele
ptpgrpdpltlyhkgiasaktyyrdehiypymylagyhcrnrnvrealqawadtatviqd
ynycredeeiykeffevandvipnllkeaaslleagsqgsalqdpecfahllrfydgick
weegsptpvlhvgwatflvqslgrfegqvrqkvrivspvltfqsekmkgmkellvatkin
ssaiklqltaqsqvqmk

SCOPe Domain Coordinates for d4x5za2:

Click to download the PDB-style file with coordinates for d4x5za2.
(The format of our PDB-style files is described here.)

Timeline for d4x5za2:

  • d4x5za2 is new in SCOPe 2.06-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d4x5za1