SCOPe 2.08: Domain d4x5za2: 4x5z A:231-459

Lineage for d4x5za2 (4x5z A:231-459)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.8: TPR-like [48452] (11 families)

5. Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (21 proteins)
   this is a repeat family; one repeat unit is 1zb1 A:166-231 found in domain

6. Protein Menin C-terminal domain [310725] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [310974] (33 PDB entries)

8. Domain d4x5za2: 4x5z A:231-459 [309965]
   Other proteins in same PDB: d4x5za1, d4x5za3
   automated match to d3u85a2
   complexed with 3xy, dms, edo, pg4, so4
   has additional insertions and/or extensions that are not grouped together

Details for d4x5za2

PDB Entry: 4x5z, 1.86 Å

PDB Description: menin in complex with mi-136

PDB Compounds: (A:) Menin

SCOPe Domain Sequences for d4x5za2:

Sequence; same for both SEQRES and ATOM records:

>d4x5za2 a.118.8.1 (A:231-459) Menin C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
drkmevafmvcainpsidlhtdslellqlqqkllwllydlghlerypmalgnladleele
ptpgrpdpltlyhkgiasaktyyrdehiypymylagyhcrnrnvrealqawadtatviqd
ynycredeeiykeffevandvipnllkeaaslleagsqgsalqdpecfahllrfydgick
weegsptpvlhvgwatflvqslgrfegqvrqkvrivs

Timeline for d4x5za2:

• d4x5za2 first appeared in SCOPe 2.06
  
• d4x5za2 appears in SCOPe 2.07