| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.27: Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain [52417] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like |
Superfamily c.27.1: Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain [52418] (2 families) ![]() automatically mapped to Pfam PF00591 |
| Family c.27.1.1: Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain [52419] (4 proteins) |
| Protein automated matches [254642] (4 species) not a true protein |
| Species Salmonella typhimurium [TaxId:99287] [311466] (3 PDB entries) |
| Domain d4x46b2: 4x46 B:71-335 [309960] Other proteins in same PDB: d4x46a1, d4x46a3, d4x46b1, d4x46b3 automated match to d4eada2 complexed with edo, so4 |
PDB Entry: 4x46 (more details), 2.2 Å
SCOPe Domain Sequences for d4x46b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4x46b2 c.27.1.1 (B:71-335) automated matches {Salmonella typhimurium [TaxId: 99287]}
dwkslnlngpivdkhstggvgdvtslmlgpmvaacggyvpmisgrglghtggtldkleai
pgfdifpddnrfreiiqdvgvaiigqtsslapadkrfyatrditatvdsiplitgsilak
klaegldalvmdvkvgsgafmptyelsealaeaivgvangagvrttalltdmnqvlassa
gnavevreavqfltgeyrnprlfdvtmalcvemlisgqlakddaearaklqavldngkaa
evfgrmvaaqkgpsdfvenydkylp
Timeline for d4x46b2: