![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.46: Methionine synthase domain-like [47643] (3 superfamilies) 4 helices; bundle, left-handed twist; right-handed superhelix |
![]() | Superfamily a.46.2: Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain [47648] (2 families) ![]() automatically mapped to Pfam PF02885 |
![]() | Family a.46.2.0: automated matches [254276] (1 protein) not a true family |
![]() | Protein automated matches [254641] (5 species) not a true protein |
![]() | Species Salmonella typhimurium [TaxId:99287] [311465] (3 PDB entries) |
![]() | Domain d4x46b1: 4x46 B:1-70 [309959] Other proteins in same PDB: d4x46a2, d4x46a3, d4x46b2, d4x46b3 automated match to d4eada1 complexed with edo, so4 |
PDB Entry: 4x46 (more details), 2.2 Å
SCOPe Domain Sequences for d4x46b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4x46b1 a.46.2.0 (B:1-70) automated matches {Salmonella typhimurium [TaxId: 99287]} mflaqeiirkkrdghalsdeeirffingirdntisegqiaalamtiffhdmtmpervslt mamrdsgtvl
Timeline for d4x46b1: