SCOPe 2.08: Domain d4x2ya_: 4x2y A:

Lineage for d4x2ya_ (4x2y A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 proteins)

6. Protein automated matches [190384] (21 species)
   not a true protein

7. Species Murine norovirus 1 [TaxId:223997] [311357] (5 PDB entries)

8. Domain d4x2ya_: 4x2y A: [309954]
   automated match to d2fyqa_
   mutant

Details for d4x2ya_

PDB Entry: 4x2y, 2.42 Å

PDB Description: crystal structure of a chimeric murine norovirus ns6 protease (inactive c139a mutant) in which the p4-p4 prime residues of the cleavage junction in the extended c-terminus have been replaced by the corresponding residues from the ns2-3 junction.

PDB Compounds: (A:) NS6 Protease,NS6 Protease

SCOPe Domain Sequences for d4x2ya_:

Sequence, based on SEQRES records:

>d4x2ya_ b.47.1.4 (A:) automated matches {Murine norovirus 1 [TaxId: 223997]}
siwsrvvqfgtgwgfwvsghvfitakhvappkgteifgrkpgdftvtssgdflkyyftsa
vrpdipamvlengcqegvvasvlvkrasgemlalavrmgsqaaikigsavvhgqtgmllt
gsnakaqdlgtipgdagcpyvykkgntwvvigvhvaatrsgntviaathgeptleawqa

Sequence, based on observed residues (ATOM records):

>d4x2ya_ b.47.1.4 (A:) automated matches {Murine norovirus 1 [TaxId: 223997]}
siwsrvvqfgtgwgfwvsghvfitakhvappkgteifgrkpgdftvtssgdflkyyftsa
vrpdipamvlengcqegvvasvlvkrasgemlalavrmgsqaaikigsavvhgqtgmllt
gsnlgtipgdagcpyvykkgntwvvigvhvaatrntviaathgeptleawqa

Timeline for d4x2ya_:

• d4x2ya_ first appeared in SCOPe 2.06
  
• d4x2ya_ appears in SCOPe 2.07