Lineage for d4x2xa_ (4x2x A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2055629Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2055630Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2057856Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 protein domains)
  6. 2058054Protein automated matches [190384] (19 species)
    not a true protein
  7. 2058111Species Murine norovirus 1 [TaxId:223997] [311357] (5 PDB entries)
  8. 2058120Domain d4x2xa_: 4x2x A: [309953]
    automated match to d2fyqa_
    mutant

Details for d4x2xa_

PDB Entry: 4x2x (more details), 2.47 Å

PDB Description: crystal structure of the murine norovirus ns6 protease (inactive c139a mutant) with a c-terminal extension to include residues p1 prime - p4 prime of ns7
PDB Compounds: (A:) ns6 protease

SCOPe Domain Sequences for d4x2xa_:

Sequence, based on SEQRES records: (download)

>d4x2xa_ b.47.1.4 (A:) automated matches {Murine norovirus 1 [TaxId: 223997]}
siwsrvvqfgtgwgfwvsghvfitakhvappkgteifgrkpgdftvtssgdflkyyftsa
vrpdipamvlengcqegvvasvlvkrasgemlalavrmgsqaaikigsavvhgqtgmllt
gsnakaqdlgtipgdagcpyvykkgntwvvigvhvaatrsgntviaathgeptlea

Sequence, based on observed residues (ATOM records): (download)

>d4x2xa_ b.47.1.4 (A:) automated matches {Murine norovirus 1 [TaxId: 223997]}
siwsrvvqfgtgwgfwvsghvfitakhvappkgteifgrkpgdftvtssgdflkyyftsa
vrpdipamvlengcqegvvasvlvkrasgemlalavrmgsqaaikigsavvhgqtgmllt
ggtipgdagcpyvykkgntwvvigvhvaatgntviaathgeptlea

SCOPe Domain Coordinates for d4x2xa_:

Click to download the PDB-style file with coordinates for d4x2xa_.
(The format of our PDB-style files is described here.)

Timeline for d4x2xa_:

  • d4x2xa_ is new in SCOPe 2.06-stable