Lineage for d4x0vg_ (4x0v G:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2832343Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2832344Protein automated matches [190075] (132 species)
    not a true protein
  7. 2832499Species Caldicellulosiruptor sp. [TaxId:1214564] [311461] (2 PDB entries)
  8. 2832507Domain d4x0vg_: 4x0v G: [309944]
    automated match to d1edga_

Details for d4x0vg_

PDB Entry: 4x0v (more details), 2.8 Å

PDB Description: structure of a gh5 family lichenase from caldicellulosiruptor sp. f32
PDB Compounds: (G:) Beta-1,3-1,4-glucanase

SCOPe Domain Sequences for d4x0vg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4x0vg_ c.1.8.0 (G:) automated matches {Caldicellulosiruptor sp. [TaxId: 1214564]}
akipeikiasrkipnnaalkfvkdmkigwnlgntfdaafenpsfddellyetawcgvktt
kqmidtvkkagfntiripvswhnhvtgsnftiskrwldrvqqvvdyamknkmyviinihh
dimpgyyypnsqhlqtsikyvksiwtqvatrfknyndhlifeavneprltgsrfewwldm
nnpecrdaveainklnqvfvdtvrstggnnvsrylmvpgyaaapeyvlidefkipkdssk
yknriiisvhayrpynfalqapnesgsvsewsvnseesrrdidyfmdklydkfvskgipv
vigefgardkngnlqsrvefaayyvraarargitccwwdnnafygngenfglldrktlkw
vypeivsammkyar

SCOPe Domain Coordinates for d4x0vg_:

Click to download the PDB-style file with coordinates for d4x0vg_.
(The format of our PDB-style files is described here.)

Timeline for d4x0vg_: