![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
![]() | Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
![]() | Family b.29.1.0: automated matches [191363] (1 protein) not a true family |
![]() | Protein automated matches [190437] (70 species) not a true protein |
![]() | Species Mycobacterium tuberculosis [TaxId:83332] [311462] (1 PDB entry) |
![]() | Domain d4wzfb1: 4wzf B:54-294 [309928] Other proteins in same PDB: d4wzfa2, d4wzfb2 automated match to d2hyka_ complexed with ca, edo |
PDB Entry: 4wzf (more details), 1.7 Å
SCOPe Domain Sequences for d4wzfb1:
Sequence, based on SEQRES records: (download)
>d4wzfb1 b.29.1.0 (B:54-294) automated matches {Mycobacterium tuberculosis [TaxId: 83332]} ggllfhdefdgpagsvpdpskwqvsnhrtpiknpvgfdrpqffgqyrdsrqnvfldgnsn lvlratregnryfgglvhglwrggigttwearikfnclapgmwpawwlsnddpgrsgeid liewygngtwpsgttvhanpdgtafetcpigvdggwhnwrvtwnpsgmyfwldyadgiep yfsvpatgiedlnepirewpfndpgykvfpvlnlavggsgggdpatgsypqemlvdwvrv f
>d4wzfb1 b.29.1.0 (B:54-294) automated matches {Mycobacterium tuberculosis [TaxId: 83332]} ggllfhdefdgpagsvpdpskwqvsnhrtpiknpvgfdrpqffgqyrdsrqnvfldgnsn lvlratregnryfgglvhglwrggigttwearikfnclapgmwpawwlsnddpgrsgeid liewygngtwpsgttvhanpdgtafetcpigvdggwhnwrvtwnpsgmyfwldyadgiep yfsvpatgnepirewpfndpgykvfpvlnlavggsgggdpatgsypqemlvdwvrvf
Timeline for d4wzfb1: