Lineage for d4wzfa1 (4wzf A:54-294)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2042196Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2042197Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2044115Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2044116Protein automated matches [190437] (53 species)
    not a true protein
  7. 2044421Species Mycobacterium tuberculosis [TaxId:83332] [311462] (1 PDB entry)
  8. 2044422Domain d4wzfa1: 4wzf A:54-294 [309926]
    Other proteins in same PDB: d4wzfa2, d4wzfb2
    automated match to d2hyka_
    complexed with ca, edo

Details for d4wzfa1

PDB Entry: 4wzf (more details), 1.7 Å

PDB Description: crystal structural basis for rv0315, an immunostimulatory antigen and pseudo beta-1, 3-glucanase of mycobacterium tuberculosis
PDB Compounds: (A:) 1,3-beta-glucanase

SCOPe Domain Sequences for d4wzfa1:

Sequence, based on SEQRES records: (download)

>d4wzfa1 b.29.1.0 (A:54-294) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
ggllfhdefdgpagsvpdpskwqvsnhrtpiknpvgfdrpqffgqyrdsrqnvfldgnsn
lvlratregnryfgglvhglwrggigttwearikfnclapgmwpawwlsnddpgrsgeid
liewygngtwpsgttvhanpdgtafetcpigvdggwhnwrvtwnpsgmyfwldyadgiep
yfsvpatgiedlnepirewpfndpgykvfpvlnlavggsgggdpatgsypqemlvdwvrv
f

Sequence, based on observed residues (ATOM records): (download)

>d4wzfa1 b.29.1.0 (A:54-294) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
ggllfhdefdgpagsvpdpskwqvsnhrtpiknpvgfdrpqffgqyrdsrqnvfldgnsn
lvlratregnryfgglvhglwrggigttwearikfnclapgmwpawwlsnddpgrsgeid
liewygngtwpsgttvhanpdgtafetcpigvdggwhnwrvtwnpsgmyfwldyadgiep
yfsvpatgnepirewpfndpgykvfpvlnlavggsgggdpatgsypqemlvdwvrvf

SCOPe Domain Coordinates for d4wzfa1:

Click to download the PDB-style file with coordinates for d4wzfa1.
(The format of our PDB-style files is described here.)

Timeline for d4wzfa1:

  • d4wzfa1 is new in SCOPe 2.06-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d4wzfa2