Lineage for d4wxrb2 (4wxr B:326-629)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2113070Family c.37.1.14: RNA helicase [52724] (4 protein domains)
    duplication: consists of two similar domains, one binds NTP and the other binds RNA; also contains an all-alpha subdomain in the C-terminal extension
  6. 2113149Protein automated matches [226986] (8 species)
    not a true protein
  7. 2113168Species Hepatitis C virus [TaxId:11103] [311460] (2 PDB entries)
  8. 2113171Domain d4wxrb2: 4wxr B:326-629 [309924]
    Other proteins in same PDB: d4wxra1, d4wxrb1
    automated match to d4oksb2
    complexed with 3vz

Details for d4wxrb2

PDB Entry: 4wxr (more details), 2.42 Å

PDB Description: x-ray crystal structure of ns3 helicase from hcv with a bound inhibitor at 2.42 a resolution
PDB Compounds: (B:) ns3

SCOPe Domain Sequences for d4wxrb2:

Sequence, based on SEQRES records: (download)

>d4wxrb2 c.37.1.14 (B:326-629) automated matches {Hepatitis C virus [TaxId: 11103]}
pgsvtvshpnieevalsttgeipfygkaiplevikggrhlifchskkkcdelaaklvalg
inavayyrgldvsviptsgdvvvvstdalmtgftgdfdsvidcntcvtqtvdfsldptft
ietttlpqdavsrtqrrgrtgrgkpgiyrfvapgerpsgmfdssvlcecydagcawyelt
paettvrlraymntpglpvcqdhlefwegvftglthidahflsqtkqsgenfpylvayqa
tvcaraqapppswdqmwkclirlkptlhgptpllyrlgavqnevtlthpitkyimtcmsa
dlev

Sequence, based on observed residues (ATOM records): (download)

>d4wxrb2 c.37.1.14 (B:326-629) automated matches {Hepatitis C virus [TaxId: 11103]}
pgsvtvshpnieevalsttgeipfygkaiplevikggrhlifchskkkcdelaaklvalg
inavayyrgldvsviptsgdvvvvstdaltgdfdsvidcntcvtqtvdfsldptftiett
tlpqdavsrtqrrgrtgrgkpgiyrfvapgerpsgmfdssvlcecydagcawyeltpaet
tvrlraymntpglpvcqdhlefwegvftglthidahflsqtkqsgenfpylvayqatvca
raqapppswdqmwkclirlkptlhgptpllyrlgavqnevtlthpitkyimtcmsadlev

SCOPe Domain Coordinates for d4wxrb2:

Click to download the PDB-style file with coordinates for d4wxrb2.
(The format of our PDB-style files is described here.)

Timeline for d4wxrb2:

  • d4wxrb2 is new in SCOPe 2.06-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d4wxrb1