Lineage for d4wxra1 (4wxr A:190-325)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2479613Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2479614Protein automated matches [190123] (156 species)
    not a true protein
  7. 2480077Species Hepatitis C virus [TaxId:11103] [311459] (2 PDB entries)
  8. 2480079Domain d4wxra1: 4wxr A:190-325 [309921]
    Other proteins in same PDB: d4wxra2, d4wxrb2
    automated match to d4ojqa1
    complexed with 3vz

Details for d4wxra1

PDB Entry: 4wxr (more details), 2.42 Å

PDB Description: x-ray crystal structure of ns3 helicase from hcv with a bound inhibitor at 2.42 a resolution
PDB Compounds: (A:) ns3

SCOPe Domain Sequences for d4wxra1:

Sequence, based on SEQRES records: (download)

>d4wxra1 c.37.1.0 (A:190-325) automated matches {Hepatitis C virus [TaxId: 11103]}
ppavpqsfqvahlhaptgsgkstkvpaayaaqgykvlvlnpsvaatlgfgaymskahgvd
pnirtgvrtittgspitystygkfladggcsggaydiiicdechstdatsilgigtvldq
aetagarlvvlatatp

Sequence, based on observed residues (ATOM records): (download)

>d4wxra1 c.37.1.0 (A:190-325) automated matches {Hepatitis C virus [TaxId: 11103]}
ppavpqsfqvahlhaptgsgkstkvpaayaaqgykvlvlnpsvaatlgfgaymskdpnir
tgvrtittgspitystygkfladggcsaydiiicdechstdatsilgigtvldqaetaga
rlvvlatatp

SCOPe Domain Coordinates for d4wxra1:

Click to download the PDB-style file with coordinates for d4wxra1.
(The format of our PDB-style files is described here.)

Timeline for d4wxra1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4wxra2