Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
Protein automated matches [190123] (156 species) not a true protein |
Species Hepatitis C virus [TaxId:11103] [311459] (2 PDB entries) |
Domain d4wxra1: 4wxr A:190-325 [309921] Other proteins in same PDB: d4wxra2, d4wxrb2 automated match to d4ojqa1 complexed with 3vz |
PDB Entry: 4wxr (more details), 2.42 Å
SCOPe Domain Sequences for d4wxra1:
Sequence, based on SEQRES records: (download)
>d4wxra1 c.37.1.0 (A:190-325) automated matches {Hepatitis C virus [TaxId: 11103]} ppavpqsfqvahlhaptgsgkstkvpaayaaqgykvlvlnpsvaatlgfgaymskahgvd pnirtgvrtittgspitystygkfladggcsggaydiiicdechstdatsilgigtvldq aetagarlvvlatatp
>d4wxra1 c.37.1.0 (A:190-325) automated matches {Hepatitis C virus [TaxId: 11103]} ppavpqsfqvahlhaptgsgkstkvpaayaaqgykvlvlnpsvaatlgfgaymskdpnir tgvrtittgspitystygkfladggcsaydiiicdechstdatsilgigtvldqaetaga rlvvlatatp
Timeline for d4wxra1: