SCOPe 2.06: Domain d4wxra1: 4wxr A:190-325

Lineage for d4wxra1 (4wxr A:190-325)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (130 species)
   not a true protein

7. Species Hepatitis C virus [TaxId:11103] [311459] (2 PDB entries)

8. Domain d4wxra1: 4wxr A:190-325 [309921]
   Other proteins in same PDB: d4wxra2, d4wxrb2
   automated match to d4ojqa1
   complexed with 3vz

Details for d4wxra1

PDB Entry: 4wxr, 2.42 Å

PDB Description: x-ray crystal structure of ns3 helicase from hcv with a bound inhibitor at 2.42 a resolution

PDB Compounds: (A:) ns3

SCOPe Domain Sequences for d4wxra1:

Sequence, based on SEQRES records:

>d4wxra1 c.37.1.0 (A:190-325) automated matches {Hepatitis C virus [TaxId: 11103]}
ppavpqsfqvahlhaptgsgkstkvpaayaaqgykvlvlnpsvaatlgfgaymskahgvd
pnirtgvrtittgspitystygkfladggcsggaydiiicdechstdatsilgigtvldq
aetagarlvvlatatp

Sequence, based on observed residues (ATOM records):

>d4wxra1 c.37.1.0 (A:190-325) automated matches {Hepatitis C virus [TaxId: 11103]}
ppavpqsfqvahlhaptgsgkstkvpaayaaqgykvlvlnpsvaatlgfgaymskdpnir
tgvrtittgspitystygkfladggcsaydiiicdechstdatsilgigtvldqaetaga
rlvvlatatp

Timeline for d4wxra1:

• d4wxra1 is new in SCOPe 2.06-stable
  
• d4wxra1 appears in SCOPe 2.07
  
• d4wxra1 appears in the current release, SCOPe 2.08