Lineage for d4wxpa2 (4wxp A:326-630)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2870435Family c.37.1.14: RNA helicase [52724] (7 proteins)
    duplication: consists of two similar domains, one binds NTP and the other binds RNA; also contains an all-alpha subdomain in the C-terminal extension
  6. 2870520Protein automated matches [226986] (8 species)
    not a true protein
  7. 2870544Species Hepatitis C virus [TaxId:11103] [311460] (2 PDB entries)
  8. 2870545Domain d4wxpa2: 4wxp A:326-630 [309920]
    Other proteins in same PDB: d4wxpa1
    automated match to d3rvba2
    complexed with 3vy, cl, na

Details for d4wxpa2

PDB Entry: 4wxp (more details), 2.08 Å

PDB Description: x-ray crystal structure of ns3 helicase from hcv with a bound fragment inhibitor at 2.08 a resolution
PDB Compounds: (A:) NS3-4 protease

SCOPe Domain Sequences for d4wxpa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wxpa2 c.37.1.14 (A:326-630) automated matches {Hepatitis C virus [TaxId: 11103]}
pgsvtvshpnieevalsntgeipfygkaipievirggrhlifchskkkcdelaaklsalg
lnavayyrgldvsviptsgdvvvvatdalmtgytgdfdsvidcntcvtqtvdfsldptft
idtttvpqdavsrsqrrgrtgrgrrgiyrfvtpgerpsgmfdssvlcecydagcawyelt
paetsvrlraylntpglpvcqdhlefwesvftglthidahflsqtkqagdnfpylvayqa
tvcaraqapppswdqmwksltrlkptllgptpllyrlgalqnevtlthpitkyimacmsa
dlevv

SCOPe Domain Coordinates for d4wxpa2:

Click to download the PDB-style file with coordinates for d4wxpa2.
(The format of our PDB-style files is described here.)

Timeline for d4wxpa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4wxpa1