SCOPe 2.08: Domain d4wxpa1: 4wxp A:186-325

Lineage for d4wxpa1 (4wxp A:186-325)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (158 species)
   not a true protein

7. Species Hepatitis C virus [TaxId:11103] [311459] (2 PDB entries)

8. Domain d4wxpa1: 4wxp A:186-325 [309919]
   Other proteins in same PDB: d4wxpa2
   automated match to d3rvba1
   complexed with 3vy, cl, na

Details for d4wxpa1

PDB Entry: 4wxp, 2.08 Å

PDB Description: x-ray crystal structure of ns3 helicase from hcv with a bound fragment inhibitor at 2.08 a resolution

PDB Compounds: (A:) NS3-4 protease

SCOPe Domain Sequences for d4wxpa1:

Sequence; same for both SEQRES and ATOM records:

>d4wxpa1 c.37.1.0 (A:186-325) automated matches {Hepatitis C virus [TaxId: 11103]}
dnssppavpqsfqvahlhaptgsgkstkvpaayaaqgykvlvlnpsvaatlgfgvymska
hgidpnirtgvraittggpitystygkfladggcsggaydiiicdechstdstsilgigt
vldqaetagarlvvlatatp

Timeline for d4wxpa1:

• d4wxpa1 first appeared in SCOPe 2.06
  
• d4wxpa1 appears in SCOPe 2.07