![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
![]() | Superfamily a.104.1: Cytochrome P450 [48264] (2 families) ![]() |
![]() | Family a.104.1.1: Cytochrome P450 [48265] (23 proteins) |
![]() | Protein Cyp119 [48278] (3 species) thermophilic P450 |
![]() | Species Sulfolobus acidocaldarius [TaxId:330779] [311443] (4 PDB entries) |
![]() | Domain d4wqja_: 4wqj A: [309915] automated match to d1f4ta_ complexed with 36y, gol, hem |
PDB Entry: 4wqj (more details), 2.7 Å
SCOPe Domain Sequences for d4wqja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4wqja_ a.104.1.1 (A:) Cyp119 {Sulfolobus acidocaldarius [TaxId: 330779]} mydwfsemrkkdpvyydgniwqvfsyrytkevlnnfskfssdltgyherledlrngkirf diptrytmltsdpplhdelrsmsadifspqklqtletfirettrslldsidpreddivkk lavplpiiviskilglpiedkekfkewsdlvafrlgkpgeifelgkkyleligyvkdhln sgtevvsrvvnsnlsdieklgyiillliagnetttnlisnsvidftrfnlwqrireenly lkaieealrysppvmrtvrktkervklgdqtieegeyvrvwiasanrdeevfhdgekfip drnpnphlsfgsgihlclgaplarleariaieefskrfrhieildtekvpnevlngykrl vvrlksn
Timeline for d4wqja_: