Lineage for d4wp8a1 (4wp8 A:54-217)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2954779Superfamily d.58.29: Nucleotide cyclase [55073] (3 families) (S)
    common fold is elaborated with additional secondary structures
  5. 2954860Family d.58.29.0: automated matches [191671] (1 protein)
    not a true family
  6. 2954861Protein automated matches [191274] (13 species)
    not a true protein
  7. 2954906Species Mycobacterium avium [TaxId:1764] [276597] (3 PDB entries)
  8. 2954909Domain d4wp8a1: 4wp8 A:54-217 [309905]
    Other proteins in same PDB: d4wp8a2, d4wp8b2
    automated match to d4wp9a_
    complexed with cl, mn, zda

Details for d4wp8a1

PDB Entry: 4wp8 (more details), 1.65 Å

PDB Description: crystal structure of adenylyl cyclase ma1120 from mycobacterium avium in complex with 2'5'-dd-3'-atp and manganese ion
PDB Compounds: (A:) Ma1120

SCOPe Domain Sequences for d4wp8a1:

Sequence, based on SEQRES records: (download)

>d4wp8a1 d.58.29.0 (A:54-217) automated matches {Mycobacterium avium [TaxId: 1764]}
rvvilftdieestalnerigdrawvklisshdklvsdlvrrqsghvvksqgdgfmvafar
peqavrcgielqralrrnanrkrheeirvrigihmgrsvrrgddlfgrnvamaarvaaqa
aggeilvsqpvrdalsrsdgirfddgrevelkgfsgtyrlfavl

Sequence, based on observed residues (ATOM records): (download)

>d4wp8a1 d.58.29.0 (A:54-217) automated matches {Mycobacterium avium [TaxId: 1764]}
rvvilftdieestalnerigdrawvklisshdklvsdlvrrqsghvvksqgdgfmvafar
peqavrcgielqralrrnanreirvrigihmgrsvrrgddlfgrnvamaarvaaqaagge
ilvsqpvrdalgirfddgrevelkgfsgtyrlfavl

SCOPe Domain Coordinates for d4wp8a1:

Click to download the PDB-style file with coordinates for d4wp8a1.
(The format of our PDB-style files is described here.)

Timeline for d4wp8a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4wp8a2