![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.16: Lumazine synthase [52120] (1 superfamily) 3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134 |
![]() | Superfamily c.16.1: Lumazine synthase [52121] (2 families) ![]() |
![]() | Family c.16.1.1: Lumazine synthase [52122] (2 proteins) |
![]() | Protein Lumazine synthase [52123] (7 species) |
![]() | Species Spinach (Spinacia oleracea) [TaxId:3562] [52127] (1 PDB entry) |
![]() | Domain d1c2ys_: 1c2y S: [30990] complexed with lmz |
PDB Entry: 1c2y (more details), 3.3 Å
SCOPe Domain Sequences for d1c2ys_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c2ys_ c.16.1.1 (S:) Lumazine synthase {Spinach (Spinacia oleracea) [TaxId: 3562]} mnelegyvtkaqsfrfaivvarfnefvtrrlmegaldtfkkysvnedidvvwvpgayelg vtaqalgksgkyhaivclgavvkgdtshydavvnsassgvlsaglnsgvpcvfgvltcdn mdqainraggkagnkgaesaltaiemaslfehhlk
Timeline for d1c2ys_: