SCOPe 2.06: Domain d4wluc1: 4wlu C:24-168

Lineage for d4wluc1 (4wlu C:24-168)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)

6. Protein automated matches [226881] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225056] (7 PDB entries)

8. Domain d4wluc1: 4wlu C:24-168 [309893]
   Other proteins in same PDB: d4wlua2, d4wlub2, d4wluc2, d4wlud2
   automated match to d2dfda1
   complexed with lmr, nad

Details for d4wluc1

PDB Entry: 4wlu, 2.14 Å

PDB Description: crystal structure of l-malate and nad bound mdh2

PDB Compounds: (C:) Malate dehydrogenase, mitochondrial

SCOPe Domain Sequences for d4wluc1:

Sequence; same for both SEQRES and ATOM records:

>d4wluc1 c.2.1.5 (C:24-168) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nakvavlgasggigqplslllknsplvsrltlydiahtpgvaadlshietkaavkgylgp
eqlpdclkgcdvvvipagvprkpgmtrddlfntnativatltaacaqhcpeamicvianp
vnstipitaevfkkhgvynpnkifg

Timeline for d4wluc1:

• d4wluc1 is new in SCOPe 2.06-stable
  
• d4wluc1 appears in SCOPe 2.07
  
• d4wluc1 appears in the current release, SCOPe 2.08