Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins) |
Protein automated matches [226881] (5 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225056] (7 PDB entries) |
Domain d4wluc1: 4wlu C:24-168 [309893] Other proteins in same PDB: d4wlua2, d4wlub2, d4wluc2, d4wlud2 automated match to d2dfda1 complexed with lmr, nad |
PDB Entry: 4wlu (more details), 2.14 Å
SCOPe Domain Sequences for d4wluc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4wluc1 c.2.1.5 (C:24-168) automated matches {Human (Homo sapiens) [TaxId: 9606]} nakvavlgasggigqplslllknsplvsrltlydiahtpgvaadlshietkaavkgylgp eqlpdclkgcdvvvipagvprkpgmtrddlfntnativatltaacaqhcpeamicvianp vnstipitaevfkkhgvynpnkifg
Timeline for d4wluc1: