Lineage for d4wlec1 (4wle C:24-168)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2844315Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)
  6. 2844864Protein automated matches [226881] (8 species)
    not a true protein
  7. 2844882Species Human (Homo sapiens) [TaxId:9606] [225056] (8 PDB entries)
  8. 2844889Domain d4wlec1: 4wle C:24-168 [309861]
    Other proteins in same PDB: d4wlea2, d4wleb2, d4wlec2, d4wled2
    automated match to d2dfda1
    complexed with cit

Details for d4wlec1

PDB Entry: 4wle (more details), 1.9 Å

PDB Description: crystal structure of citrate bound mdh2
PDB Compounds: (C:) Malate dehydrogenase, mitochondrial

SCOPe Domain Sequences for d4wlec1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wlec1 c.2.1.5 (C:24-168) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nakvavlgasggigqplslllknsplvsrltlydiahtpgvaadlshietkaavkgylgp
eqlpdclkgcdvvvipagvprkpgmtrddlfntnativatltaacaqhcpeamicvianp
vnstipitaevfkkhgvynpnkifg

SCOPe Domain Coordinates for d4wlec1:

Click to download the PDB-style file with coordinates for d4wlec1.
(The format of our PDB-style files is described here.)

Timeline for d4wlec1: