Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins) |
Protein automated matches [226881] (8 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225056] (8 PDB entries) |
Domain d4wleb1: 4wle B:24-168 [309859] Other proteins in same PDB: d4wlea2, d4wleb2, d4wlec2, d4wled2 automated match to d2dfda1 complexed with cit |
PDB Entry: 4wle (more details), 1.9 Å
SCOPe Domain Sequences for d4wleb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4wleb1 c.2.1.5 (B:24-168) automated matches {Human (Homo sapiens) [TaxId: 9606]} nakvavlgasggigqplslllknsplvsrltlydiahtpgvaadlshietkaavkgylgp eqlpdclkgcdvvvipagvprkpgmtrddlfntnativatltaacaqhcpeamicvianp vnstipitaevfkkhgvynpnkifg
Timeline for d4wleb1: