SCOPe 2.07: Domain d4wf5b_: 4wf5 B:

Lineage for d4wf5b_ (4wf5 B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.13: DsbA-like [100953] (4 proteins)
   contains an all-alpha subdomain insertion

6. Protein Disulfide-bond formation facilitator (DsbA) [100954] (4 species)
   the insert subdomain is a 4-helical bundle

7. Species Escherichia coli [TaxId:469008] [311451] (4 PDB entries)

8. Domain d4wf5b_: 4wf5 B: [309854]
   automated match to d1fvka_
   complexed with cu, edo, gol, wf4

Details for d4wf5b_

PDB Entry: 4wf5, 1.45 Å

PDB Description: crystal structure of e.coli dsba soaked with compound 4

PDB Compounds: (B:) thiol:disulfide interchange protein

SCOPe Domain Sequences for d4wf5b_:

Sequence; same for both SEQRES and ATOM records:

>d4wf5b_ c.47.1.13 (B:) Disulfide-bond formation facilitator (DsbA) {Escherichia coli [TaxId: 469008]}
aqyedgkqyttlekpvagapqvleffsffcphcyqfeevlhisdnvkkklpegvkmtkyh
vnfmggdlgkdltqawavamalgvedkvtvplfegvqktqtirsasdirdvfinagikge
eydaawnsfvvkslvaqqekaaadvqlrgvpamfvngkyqlnpqgmdtsnmdvfvqqyad
tvkylsek

Timeline for d4wf5b_:

• d4wf5b_ first appeared in SCOPe 2.06
  
• d4wf5b_ appears in the current release, SCOPe 2.08