Lineage for d4weyb_ (4wey B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878376Family c.47.1.13: DsbA-like [100953] (4 proteins)
    contains an all-alpha subdomain insertion
  6. 2878377Protein Disulfide-bond formation facilitator (DsbA) [100954] (4 species)
    the insert subdomain is a 4-helical bundle
  7. 2878378Species Escherichia coli [TaxId:469008] [311451] (4 PDB entries)
  8. 2878382Domain d4weyb_: 4wey B: [309850]
    automated match to d1fvka_
    complexed with edo, eg6

Details for d4weyb_

PDB Entry: 4wey (more details), 1.55 Å

PDB Description: crystal structure of e.coli dsba in complex with compound 17
PDB Compounds: (B:) thiol:disulfide interchange protein

SCOPe Domain Sequences for d4weyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4weyb_ c.47.1.13 (B:) Disulfide-bond formation facilitator (DsbA) {Escherichia coli [TaxId: 469008]}
aqyedgkqyttlekpvagapqvleffsffcphcyqfeevlhisdnvkkklpegvkmtkyh
vnfmggdlgkdltqawavamalgvedkvtvplfegvqktqtirsasdirdvfinagikge
eydaawnsfvvkslvaqqekaaadvqlrgvpamfvngkyqlnpqgmdtsnmdvfvqqyad
tvkylsek

SCOPe Domain Coordinates for d4weyb_:

Click to download the PDB-style file with coordinates for d4weyb_.
(The format of our PDB-style files is described here.)

Timeline for d4weyb_: