| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.13: DsbA-like [100953] (4 proteins) contains an all-alpha subdomain insertion |
| Protein Disulfide-bond formation facilitator (DsbA) [100954] (4 species) the insert subdomain is a 4-helical bundle |
| Species Escherichia coli [TaxId:469008] [311451] (4 PDB entries) |
| Domain d4weya_: 4wey A: [309849] automated match to d1fvka_ complexed with edo, eg6 |
PDB Entry: 4wey (more details), 1.55 Å
SCOPe Domain Sequences for d4weya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4weya_ c.47.1.13 (A:) Disulfide-bond formation facilitator (DsbA) {Escherichia coli [TaxId: 469008]}
aqyedgkqyttlekpvagapqvleffsffcphcyqfeevlhisdnvkkklpegvkmtkyh
vnfmggdlgkdltqawavamalgvedkvtvplfegvqktqtirsasdirdvfinagikge
eydaawnsfvvkslvaqqekaaadvqlrgvpamfvngkyqlnpqgmdtsnmdvfvqqyad
tvkylsek
Timeline for d4weya_: