SCOPe 2.08: Domain d4we8a2: 4we8 A:330-502

Lineage for d4we8a2 (4we8 A:330-502)

1. Root: SCOPe 2.08

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.0: automated matches [254278] (1 protein)
   not a true family

6. Protein automated matches [254645] (42 species)
   not a true protein

7. Species Influenza A virus [TaxId:1331560] [311453] (2 PDB entries)

8. Domain d4we8a2: 4we8 A:330-502 [309842]
   Other proteins in same PDB: d4we8a1
   automated match to d1ha0a2
   complexed with nag

Details for d4we8a2

PDB Entry: 4we8, 2.1 Å

PDB Description: the crystal structure of hemagglutinin of influenza virus a/victoria/361/2011

PDB Compounds: (A:) Hemagglutinin

SCOPe Domain Sequences for d4we8a2:

Sequence; same for both SEQRES and ATOM records:

>d4we8a2 h.3.1.0 (A:330-502) automated matches {Influenza A virus [TaxId: 1331560]}
gifgaiagfiengwegmvdgwygfrhqnsegrgqaadlkstqaaidqingklnrligktn
ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
ktkkqlrenaedmgngcfkiyhkcdnacigsirngtydhdvyrdealnnrfqi

Timeline for d4we8a2:

• d4we8a2 first appeared in SCOPe 2.06
  
• d4we8a2 appears in SCOPe 2.07