| Class h: Coiled coil proteins [57942] (7 folds) |
| Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) ![]() |
| Family h.3.1.0: automated matches [254278] (1 protein) not a true family |
| Protein automated matches [254645] (42 species) not a true protein |
| Species Influenza A virus [TaxId:1331560] [311453] (2 PDB entries) |
| Domain d4we8a2: 4we8 A:330-502 [309842] Other proteins in same PDB: d4we8a1 automated match to d1ha0a2 complexed with nag |
PDB Entry: 4we8 (more details), 2.1 Å
SCOPe Domain Sequences for d4we8a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4we8a2 h.3.1.0 (A:330-502) automated matches {Influenza A virus [TaxId: 1331560]}
gifgaiagfiengwegmvdgwygfrhqnsegrgqaadlkstqaaidqingklnrligktn
ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
ktkkqlrenaedmgngcfkiyhkcdnacigsirngtydhdvyrdealnnrfqi
Timeline for d4we8a2: