SCOPe 2.07: Domain d4we8a1: 4we8 A:8-325

Lineage for d4we8a1 (4we8 A:8-325)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)

6. Protein Hemagglutinin [49824] (19 species)
   includes rudiment esterase domain

7. Species Influenza A virus, different strains [TaxId:11320] [49825] (127 PDB entries)

8. Domain d4we8a1: 4we8 A:8-325 [309841]
   Other proteins in same PDB: d4we8a2
   automated match to d1ha0a1
   complexed with nag

Details for d4we8a1

PDB Entry: 4we8, 2.1 Å

PDB Description: the crystal structure of hemagglutinin of influenza virus a/victoria/361/2011

PDB Compounds: (A:) Hemagglutinin

SCOPe Domain Sequences for d4we8a1:

Sequence; same for both SEQRES and ATOM records:

>d4we8a1 b.19.1.2 (A:8-325) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
nstatlclghhavpngtivktitndqievtnatelvqnssigeicdsphqildgenctli
dallgdpqcdgfqnkkwdlfverskaysncypydvpdyaslrslvassgtlefnnesfnw
tgvtqngtssacirrsnnsffsrlnwlthlnfkypalnvtmpnneqfdklyiwgvhhpgt
dkdqiflyaqssgritvstkrsqqavipnigsrprirnipsrisiywtivkpgdillins
tgnliaprgyfkirsgkssimrsdapigkcnsecitpngsipndkpfqnvnritygacpr
yvkqstlklatgmrnvpe

Timeline for d4we8a1:

• d4we8a1 first appeared in SCOPe 2.06
  
• d4we8a1 appears in the current release, SCOPe 2.08