SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d4we7d1 (4we7 D:1-268)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2040266Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2040267Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2040896Family b.19.1.0: automated matches [227246] (1 protein)
    not a true family
  6. 2040897Protein automated matches [227017] (27 species)
    not a true protein
  7. 2041052Species Influenza a virus [TaxId:1392907] [311455] (1 PDB entry)
  8. 2041056Domain d4we7d1: 4we7 D:1-268 [309838]
    Other proteins in same PDB: d4we7a2, d4we7a3, d4we7b2, d4we7b3, d4we7c2, d4we7c3, d4we7d2, d4we7d3
    automated match to d3s13a_
    complexed with nag

Details for d4we7d1

PDB Entry: 4we7 (more details), 2.5 Å

PDB Description: Structure and receptor binding preferences of recombinant human A(H3N2) virus hemagglutinins
PDB Compounds: (D:) Hemagglutinin HA1 chain

SCOPe Domain Sequences for d4we7d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4we7d1 b.19.1.0 (D:1-268) automated matches {Influenza a virus [TaxId: 1392907]}
elvqssstgeicnsphqildgenctlidallgdpqcdgfqnkkwdlfverskahsncypy
dvpdyaslrslvassgtlefnnesfnwtgvtqngtssacirrsnnsffsrlnwlthlnfk
ypalnvtmpnneqfdklyiwgvhhpgtdkdqiflyaqaagritvstkrsqqavipnvgsr
prvrnipsrvsiywtivkpgdillinstgnliaprgyfkirsgkssimrsdapigkcnsa
citpngsipndkpfqnvnritygacpry

SCOPe Domain Coordinates for d4we7d1:

Click to download the PDB-style file with coordinates for d4we7d1.
(The format of our PDB-style files is described here.)

Timeline for d4we7d1:

  • d4we7d1 is new in SCOPe 2.06-stable