Lineage for d4we7d1 (4we7 D:1-268)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2775473Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2775474Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2776220Family b.19.1.0: automated matches [227246] (1 protein)
    not a true family
  6. 2776221Protein automated matches [227017] (58 species)
    not a true protein
  7. 2776605Species Influenza A virus [TaxId:1392907] [311455] (1 PDB entry)
  8. 2776609Domain d4we7d1: 4we7 D:1-268 [309838]
    Other proteins in same PDB: d4we7a2, d4we7a3, d4we7b2, d4we7b3, d4we7c2, d4we7c3, d4we7d2, d4we7d3
    automated match to d3s13a_
    complexed with nag

Details for d4we7d1

PDB Entry: 4we7 (more details), 2.5 Å

PDB Description: structure and receptor binding preferences of recombinant human a(h3n2) virus hemagglutinins
PDB Compounds: (D:) Hemagglutinin HA1 chain

SCOPe Domain Sequences for d4we7d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4we7d1 b.19.1.0 (D:1-268) automated matches {Influenza A virus [TaxId: 1392907]}
elvqssstgeicnsphqildgenctlidallgdpqcdgfqnkkwdlfverskahsncypy
dvpdyaslrslvassgtlefnnesfnwtgvtqngtssacirrsnnsffsrlnwlthlnfk
ypalnvtmpnneqfdklyiwgvhhpgtdkdqiflyaqaagritvstkrsqqavipnvgsr
prvrnipsrvsiywtivkpgdillinstgnliaprgyfkirsgkssimrsdapigkcnsa
citpngsipndkpfqnvnritygacpry

SCOPe Domain Coordinates for d4we7d1:

Click to download the PDB-style file with coordinates for d4we7d1.
(The format of our PDB-style files is described here.)

Timeline for d4we7d1: