SCOPe 2.08: Domain d4we6a1: 4we6 A:1-270

Lineage for d4we6a1 (4we6 A:1-270)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.0: automated matches [227246] (1 protein)
   not a true family

6. Protein automated matches [227017] (58 species)
   not a true protein

7. Species Influenza A virus [TaxId:529795] [311457] (1 PDB entry)

8. Domain d4we6a1: 4we6 A:1-270 [309825]
   Other proteins in same PDB: d4we6a2, d4we6b2
   automated match to d3s13a_
   complexed with gol, nag

Details for d4we6a1

PDB Entry: 4we6, 1.9 Å

PDB Description: the crystal structure of hemagglutinin ha1 domain from influenza virus a/perth/142/2007(h3n2)

PDB Compounds: (A:) Hemagglutinin HA1 chain

SCOPe Domain Sequences for d4we6a1:

Sequence; same for both SEQRES and ATOM records:

>d4we6a1 b.19.1.0 (A:1-270) automated matches {Influenza A virus [TaxId: 529795]}
elvqssstgeicdsphqildgknctlidallgdpqcdgfqnkkwdlfverskaysncypy
dvpdyaslrslvassgtlefnnesfnwtgvtqngtssacirrsknsffsrlnwlthlnfk
ypalnvtmpnneqfdklyiwgvhhpgtdkdqiflyaqasgritvstkrsqqtvspnigsr
prvrnipsrisiywtivkpgdillinstgnliaprgyfkirsgkssimrsdapigkcnse
citpngsipndkpfqnvnritygacpryvk

Timeline for d4we6a1:

• d4we6a1 first appeared in SCOPe 2.06
  
• d4we6a1 appears in SCOPe 2.07