Lineage for d4we5b_ (4we5 B:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3040824Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 3040825Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 3041799Family h.3.1.0: automated matches [254278] (1 protein)
    not a true family
  6. 3041800Protein automated matches [254645] (42 species)
    not a true protein
  7. 3042003Species Influenza A virus [TaxId:385624] [311458] (1 PDB entry)
  8. 3042004Domain d4we5b_: 4we5 B: [309824]
    Other proteins in same PDB: d4we5a_
    automated match to d4uo6b_
    complexed with nag

Details for d4we5b_

PDB Entry: 4we5 (more details), 2.1 Å

PDB Description: the crystal structure of hemagglutinin from a/port chalmers/1/1973 influenza virus
PDB Compounds: (B:) Hemagglutinin HA2 chain

SCOPe Domain Sequences for d4we5b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4we5b_ h.3.1.0 (B:) automated matches {Influenza A virus [TaxId: 385624]}
gifgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn
ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
ktrrqlrenaedmgngcfkiyhkcdnacigsirngtydhdvyrdealnnrfq

SCOPe Domain Coordinates for d4we5b_:

Click to download the PDB-style file with coordinates for d4we5b_.
(The format of our PDB-style files is described here.)

Timeline for d4we5b_: