Lineage for d4wa6f_ (4wa6 F:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2739463Fold a.301: Sus1-like [310571] (1 superfamily)
    5 helices; articulated hairpin fold
  4. 2739464Superfamily a.301.1: Sus1-like [310603] (1 family) (S)
    Pfam PF10163
    interactions with Sac3, Cdc31 described in PubMed 19328066
  5. 2739465Family a.301.1.1: Sus1-like [310653] (3 proteins)
  6. 2739472Protein Sus1 [310814] (1 species)
  7. 2739473Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [311080] (14 PDB entries)
  8. 2739502Domain d4wa6f_: 4wa6 F: [309820]
    automated match to d3fwbc_
    complexed with zn; mutant

Details for d4wa6f_

PDB Entry: 4wa6 (more details), 2.36 Å

PDB Description: structure of yeast saga dubm with sgf73 n59d mutant at 2.36 angstroms resolution
PDB Compounds: (F:) Transcription and mRNA export factor SUS1

SCOPe Domain Sequences for d4wa6f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wa6f_ a.301.1.1 (F:) Sus1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mdtaqlksqiqqylvesgnyelisnelkarllqegwvdkvkdltksemninestnftqil
stvepkalemvsdstretvlkqirefleeivdt

SCOPe Domain Coordinates for d4wa6f_:

Click to download the PDB-style file with coordinates for d4wa6f_.
(The format of our PDB-style files is described here.)

Timeline for d4wa6f_: