![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.301: Sus1-like [310571] (1 superfamily) 5 helices; articulated hairpin fold |
![]() | Superfamily a.301.1: Sus1-like [310603] (1 family) ![]() Pfam PF10163 interactions with Sac3, Cdc31 described in PubMed 19328066 |
![]() | Family a.301.1.1: Sus1-like [310653] (3 proteins) |
![]() | Protein Sus1 [310814] (1 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [311080] (14 PDB entries) |
![]() | Domain d4wa6b_: 4wa6 B: [309819] automated match to d3fwbc_ complexed with zn; mutant |
PDB Entry: 4wa6 (more details), 2.36 Å
SCOPe Domain Sequences for d4wa6b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4wa6b_ a.301.1.1 (B:) Sus1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} mtmdtaqlksqiqqylvesgnyelisnelkarllqegwvdkvkdltksemninestnftq ilstvepkalemvsdstretvlkqirefleeivdtq
Timeline for d4wa6b_: