Lineage for d4wa2e2 (4wa2 E:330-503)
- Root: SCOPe 2.07
Class h: Coiled coil proteins [57942] (7 folds) 
Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
core: trimeric coiled coil
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) 
Family h.3.1.0: automated matches [254278] (1 protein)
not a true familyProtein automated matches [254645] (42 species)
not a true protein
Species Influenza A virus (a/harbor seal/massachusetts/1/2011(h3n8)) [TaxId:1136533] [311450] (2 PDB entries) 
Domain d4wa2e2: 4wa2 E:330-503 [309813]
Other proteins in same PDB: d4wa2a1, d4wa2b1, d4wa2c1, d4wa2d1, d4wa2e1, d4wa2f1
automated match to d1ha0a2
complexed with nag
Details for d4wa2e2
PDB Entry: 4wa2 (more details), 2.5 Å
PDB Description: the crystal structure of hemagglutinin from a h3n8 influenza virus isolated from new england harbor seals in complex with 3'sln
PDB Compounds: (E:) HemagglutininSCOPe Domain Sequences for d4wa2e2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4wa2e2 h.3.1.0 (E:330-503) automated matches {Influenza A virus (a/harbor seal/massachusetts/1/2011(h3n8)) [TaxId: 1136533]}
glfgaiagfiengwegmidgwygfrhknsegtgqaadlkstqaaidqingklnrviektn
ekfhqiekeflevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
ktrrqlrenaedmgngcfkiyhkcdnaciesirngtydhdiyrdealnnrfqik
SCOPe Domain Coordinates for d4wa2e2:
Click to download the PDB-style file with coordinates for d4wa2e2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4wa2e2:
View in 3D
